Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAE PRDRLSPESQLTEAPDRASASPRQLRSSVCERSSEFEDFWR
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 91

Specifications

Our Abpromise guarantee covers the use of ab152422 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GFI 1
    • GFI1
    • GFI1_HUMAN
    • Growth factor independence 1
    • Growth factor independent 1
    • Growth factor independent protein 1
    • SCN2
    • Zinc finger protein 163
    • Zinc finger protein Gfi 1
    • Zinc finger protein Gfi-1
    • Zinc finger protein Gfi1
    • ZNF 163
    • ZNF163
    see all
  • Function
    Transcription factor regulating the expression of genes active during S-phase of the cell cycle in hematopoietic cells. Represses ELA2 transcription.
  • Involvement in disease
    Defects in GFI1 are a cause of neutropenia severe congenital autosomal dominant type 2 (SCN2) [MIM:613107]. SCN2 is a disorder of hematopoiesis characterized by a maturation arrest of granulopoiesis at the level of promyelocytes with peripheral blood absolute neutrophil counts below 0.5 x 10(9)/l and early onset of severe bacterial infections.
    Defects in GFI1 are a cause of dominant nonimmune chronic idiopathic neutropenia of adults (NI-CINA) [MIM:607847]. NI-CINA is a relatively mild form of neutropenia diagnosed in adults, but predisposing to leukemia in a subset of patients.
  • Sequence similarities
    Contains 6 C2H2-type zinc fingers.
  • Domain
    The Gly/Ala-rich region may indicate that Gfi-1 is a repressor of its target genes.
  • Post-translational
    modifications
    Ubiquitinated.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152422 stained with Coomassie Blue.

References

ab152422 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152422.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up