Overview

  • Product nameRecombinant Human GGCT protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO75223
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMANSGCKDVTGPDEESFLYFAYGSNLLTER IHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVW GVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNY ESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDII KKGETQTL
    • Molecular weight23 kDa including tags
    • Amino acids1 to 188
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103053 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab103053 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • C7orf24
    • CRF21
    • Cytochrome c-releasing factor 21
    • Gamma glutamyl cyclotransferase
    • Gamma-glutamylcyclotransferase
    • GCTG
    • GGC
    • Ggct
    • GGCT_HUMAN
    see all
  • FunctionCatalyzes the formation of 5-oxoproline from gamma-glutamyl dipeptides and may play a significant role in glutathione homeostasis. Induces release of cytochrome c from mitochondria with resultant induction of apoptosis.
  • Sequence similaritiesBelongs to the gamma-glutamylcyclotransferase family.
  • Information by UniProt

Recombinant Human GGCT protein images

  • 15% SDS-PAGE analysis of 3µg of ab103053.

References for Recombinant Human GGCT protein (ab103053)

ab103053 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103053.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"