Recombinant Human Ghrelin Receptor protein (ab114485)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATC VALFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDL VRLWQYRPWNFGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLR AKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRP TEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLWRRRRGDAVVG ASLRDQNHKQTVKMLGGSQRALRLSLAGPILSLCLLPSL
    • Molecular weight
      58 kDa including tags
    • Amino acids
      1 to 289

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114485 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GH releasing peptide receptor
    • GH-releasing peptide receptor
    • Ghrelin receptor
    • GHRP
    • GHRPR
    • GHS-R
    • GHSR
    • GHSR_HUMAN
    • Growth hormone secretagogue receptor 1
    • Growth hormone secretagogue receptor type 1
    • growth hormone secretatgogue receptor
    see all
  • Function
    Receptor for ghrelin, coupled to G-alpha-11 proteins. Stimulates growth hormone secretion. Binds also other growth hormone releasing peptides (GHRP) (e.g. Met-enkephalin and GHRP-6) as well as non-peptide, low molecular weight secretagogues (e.g. L-692,429, MK-0677, adenosine).
  • Tissue specificity
    Pituitary and hypothalamus.
  • Involvement in disease
    Defects in GHSR may be a cause of idiopathic short stature autosomal (ISSA) [MIM:604271]. Short stature is defined by a subnormal rate of growth.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human Ghrelin Receptor protein images

  • 12.5% SDS-PAGE showing ab114485 at approximately 57.86kDa stained with Coomassie Blue.

References for Recombinant Human Ghrelin Receptor protein (ab114485)

ab114485 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114485.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up