Recombinant Human Ghrelin Receptor protein (ab114485)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATC VALFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDL VRLWQYRPWNFGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLR AKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRP TEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLWRRRRGDAVVG ASLRDQNHKQTVKMLGGSQRALRLSLAGPILSLCLLPSL
    • Molecular weight
      58 kDa including tags
    • Amino acids
      1 to 289

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114485 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GH releasing peptide receptor
    • GH-releasing peptide receptor
    • Ghrelin receptor
    • GHRP
    • GHRPR
    • GHS-R
    • GHSR
    • GHSR_HUMAN
    • Growth hormone secretagogue receptor 1
    • Growth hormone secretagogue receptor type 1
    • growth hormone secretatgogue receptor
    see all
  • Function
    Receptor for ghrelin, coupled to G-alpha-11 proteins. Stimulates growth hormone secretion. Binds also other growth hormone releasing peptides (GHRP) (e.g. Met-enkephalin and GHRP-6) as well as non-peptide, low molecular weight secretagogues (e.g. L-692,429, MK-0677, adenosine).
  • Tissue specificity
    Pituitary and hypothalamus.
  • Involvement in disease
    Defects in GHSR may be a cause of idiopathic short stature autosomal (ISSA) [MIM:604271]. Short stature is defined by a subnormal rate of growth.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114485 at approximately 57.86kDa stained with Coomassie Blue.

References

ab114485 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114485.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up