Recombinant Human Ghrelin Receptor protein (ab114485)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ92847
    • SpeciesHuman
    • SequenceMWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATC VALFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDL VRLWQYRPWNFGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLR AKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRP TEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLWRRRRGDAVVG ASLRDQNHKQTVKMLGGSQRALRLSLAGPILSLCLLPSL
    • Molecular weight58 kDa including tags
    • Amino acids1 to 289

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114485 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GH releasing peptide receptor
    • GH-releasing peptide receptor
    • Ghrelin receptor
    • GHRP
    • GHRPR
    • GHS-R
    • GHSR
    • GHSR_HUMAN
    • Growth hormone secretagogue receptor 1
    • Growth hormone secretagogue receptor type 1
    • growth hormone secretatgogue receptor
    see all
  • FunctionReceptor for ghrelin, coupled to G-alpha-11 proteins. Stimulates growth hormone secretion. Binds also other growth hormone releasing peptides (GHRP) (e.g. Met-enkephalin and GHRP-6) as well as non-peptide, low molecular weight secretagogues (e.g. L-692,429, MK-0677, adenosine).
  • Tissue specificityPituitary and hypothalamus.
  • Involvement in diseaseDefects in GHSR may be a cause of idiopathic short stature autosomal (ISSA) [MIM:604271]. Short stature is defined by a subnormal rate of growth.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 1 family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human Ghrelin Receptor protein images

  • 12.5% SDS-PAGE showing ab114485 at approximately 57.86kDa stained with Coomassie Blue.

References for Recombinant Human Ghrelin Receptor protein (ab114485)

ab114485 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114485.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"