Overview

  • Product name
    Recombinant Human GHRHR protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      HMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWDGLLCWPTAGSGE WVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEE ESYFSTVKII
    • Molecular weight
      38 kDa including tags
    • Amino acids
      23 to 132

Specifications

Our Abpromise guarantee covers the use of ab114388 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114388 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • GHRFR
    • GHRH R
    • GHRH receptor
    • Ghrhr
    • GHRHR_HUMAN
    • GHRHRpsv
    • GRF R
    • GRF receptor
    • GRFR
    • Growth hormone releasing factor receptor
    • Growth hormone releasing hormone receptor
    • Growth hormone-releasing factor receptor
    • Growth hormone-releasing hormone receptor
    see all
  • Function
    Receptor for GRF, coupled to G proteins which activate adenylyl cyclase. Stimulates somatotroph cell growth, growth hormone gene transcription and growth hormone secretion.
  • Tissue specificity
    Pituitary gland.
  • Involvement in disease
    Defects in GHRHR are a cause of growth hormone deficiency isolated type 1B (IGHD1B) [MIM:612781]; also known as dwarfism of Sindh. IGHD1B is an autosomal recessive deficiency of GH which causes short stature. IGHD1B patients have low but detectable levels of GH.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 2 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab114388 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab114388 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114388.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up