Overview

  • Product nameRecombinant Human GHRHR protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ02643
    • SpeciesHuman
    • SequenceHMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWDGLLCWPTAGSGE WVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEE ESYFSTVKII
    • Molecular weight38 kDa including tags
    • Amino acids23 to 132

Specifications

Our Abpromise guarantee covers the use of ab114388 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114388 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • GHRFR
    • GHRH R
    • GHRH receptor
    • Ghrhr
    • GHRHR_HUMAN
    • GHRHRpsv
    • GRF R
    • GRF receptor
    • GRFR
    • Growth hormone releasing factor receptor
    • Growth hormone releasing hormone receptor
    • Growth hormone-releasing factor receptor
    • Growth hormone-releasing hormone receptor
    see all
  • FunctionReceptor for GRF, coupled to G proteins which activate adenylyl cyclase. Stimulates somatotroph cell growth, growth hormone gene transcription and growth hormone secretion.
  • Tissue specificityPituitary gland.
  • Involvement in diseaseDefects in GHRHR are a cause of growth hormone deficiency isolated type 1B (IGHD1B) [MIM:612781]; also known as dwarfism of Sindh. IGHD1B is an autosomal recessive deficiency of GH which causes short stature. IGHD1B patients have low but detectable levels of GH.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 2 family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human GHRHR protein images

  • ab114388 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human GHRHR protein (ab114388)

ab114388 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114388.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"