Recombinant Human GilZ / TilZ protein (ab114823)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ99576
    • SpeciesHuman
    • SequenceMAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQ LQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQTMLS ILLFFHSASGASVVAIDNKIEQAMDLVKNHLMYAVREEVEILKEQIRELV EKNSQLERENTLLKTLASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV
    • Molecular weight48 kDa including tags
    • Amino acids1 to 200

Specifications

Our Abpromise guarantee covers the use of ab114823 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Delta sleep-inducing peptide immunoreactor
    • DIP
    • DSIP immunoreactive leucine zipper protein
    • DSIP-immunoreactive peptide
    • Dsip1
    • Dsipi
    • GILZ
    • Glucocorticoid-induced leucine zipper protein
    • hDIP
    • Protein DIP
    • T22D3_HUMAN
    • TSC-22-like protein
    • TSC-22-related protein
    • TSC-22R
    • TSC22 domain family protein 3
    • TSC22 domain family, member 3
    • TSC22 related inducible leucine zipper 3
    • TSC22D3
    see all
  • FunctionProtects T-cells from IL2 deprivation-induced apoptosis through the inhibition of FOXO3A transcriptional activity that leads to the down-regulation of the pro-apoptotic factor BCL2L11. In macrophages, plays a role in the anti-inflammatory and immunosuppressive effects of glucocorticoids and IL10. In T-cells, inhibits anti-CD3-induced NFKB1 nuclear translocation. In vitro, suppresses AP1 and NFKB1 DNA-binding activities.
  • Tissue specificityExpressed in brain, lung, spleen and skeletal muscle. Lower levels detected in heart and kidney. Not detected in the pancreas. In non-lymphoid tissues, in the absence of inflammation, the major source of constitutive expression is the macrophage lineage. Also expressed in cells from different hemopoietic cell lineages, including bone marrow cells, CD34+ stem cells, mature B- and T-cells, monocytes and granulocytes. Down-regulated in activated macrophages from inflammatory lesions of delayed-type hypersensitivity (DTH) reactions, such as in tuberculosis and in Crohn disease, whereas in Burkitt lymphoma, persists in macrophages involved in the phagocytosis of apoptotic malignant cells.
  • Sequence similaritiesBelongs to the TSC-22/Dip/Bun family.
  • DomainThe leucine-zipper is involved in homodimerization.
  • Information by UniProt

Recombinant Human GilZ / TilZ protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human GilZ / TilZ protein (ab114823)

ab114823 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114823.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"