Recombinant Human GIMAP8 protein (ab165683)

Overview

  • Product name
    Recombinant Human GIMAP8 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSEQSCQMSELRLLLLGKCRSGKSATGNAILGKHVFKSKFSDQTVIKMCQ RESWVLRERKVVVIDTPDLFSSIACAEDKQRNIQHCLELSAPSLHALLLV IAIGHFTREDEETAKGIQQVFGAEARRHIIIVFTRKDDLGDDLLQDFIEK NKPLKQLVQDYEGRYCIFNNKTNSKDEQITQVLELLRKVESLVNTNGGPY HVNFKTEGSRFQDCVNEAASQEGDKPQGPRERQLQSTGPEQNPGTSELTV LLVGKRGAGKSAAGNSILGRQAFQTGFSEQSVTQSFLSESRSWRKKKVSI IDAPDISSLKNIDSEVRKHICTGPHAFLLVTPLGFYTKNDEAVLSTIQNN FGEKFFEYMIILLTRKEDLGDQDLDTFLRNSNKALYGLIQKCKNRYSAFN YRATGEEEQRQADELLEKIESMVHQNGNKHCVFREKETLNIVLVGRSGTG KSATGNSILGSLVFTSRLRAQPVTKTSQSGRRTWDGQEVVVVDTPSFNQM LDVEKDPSRLEEEVKRCLSCCEKGDTFFVLVFQLGRFTEEDKTAVAKLEA IFGADFTKYAIMLFTRKEDLGAGNLEDFMKNSDNKALRRIFKKCGRRVCA FNNKETGQAQETQVKALLTKVNDLRKESGWSGYPHTQENVSKLIKNVQEM SQAEKLLKNLIGILQ
    • Amino acids
      1 to 665
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165683 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GTPase IMAP family member 8
    • hIAN6
    • Human immune associated nucleotide 6
    • IAN 9
    • IAN6
    • IAN9
    • IANT
    • Immune associated nucleotide
    • Immune-associated nucleotide-binding protein 9
    • Protein IanT
    see all
  • Relevance
    This gene encodes a protein belonging to the GTP binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1.
  • Cellular localization
    Endoplasmic reticulum. Golgi apparatus. Mitochondrion

Images

  • ab165683 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165683 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165683.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up