Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVATKTFALLLLSLFLAVGLGEKKEGHFSALPSLPVGSHAKVSSPQPRGP RYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALE LASQANRKEEEAVEPQSSPAKNPSDEDLLRDLLIQELLACLLDQTNLCRL RSR
    • Molecular weight
      43 kDa including tags
    • Amino acids
      1 to 153
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112292 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • Gastric Inhibitory Peptide
    • Gastric inhibitory polypeptide
    • Gastric inhibitory polypeptide precursor
    • GIP
    • GIP_HUMAN
    • Glucose dependent insulinotropic polypeptide
    • Glucose-dependent insulinotropic polypeptide
    • Incretin hormone
    see all
  • Function
    Potent stimulator of insulin secretion and relatively poor inhibitor of gastric acid secretion.
  • Sequence similarities
    Belongs to the glucagon family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab112292 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab112292 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112292.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up