Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVATKTFALLLLSLFLAVGLGEKKEGHFSALPSLPVGSHAKVSSPQPRGP RYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALE LASQANRKEEEAVEPQSSPAKNPSDEDLLRDLLIQELLACLLDQTNLCRL RSR
    • Molecular weight
      43 kDa including tags
    • Amino acids
      1 to 153
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112292 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • Gastric Inhibitory Peptide
    • Gastric inhibitory polypeptide
    • Gastric inhibitory polypeptide precursor
    • GIP
    • GIP_HUMAN
    • Glucose dependent insulinotropic polypeptide
    • Glucose-dependent insulinotropic polypeptide
    • Incretin hormone
    see all
  • Function
    Potent stimulator of insulin secretion and relatively poor inhibitor of gastric acid secretion.
  • Sequence similarities
    Belongs to the glucagon family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human GIP protein images

  • ab112292 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human GIP protein (ab112292)

ab112292 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112292.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up