Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSEKKEGHFSALPSLPVGSHAKVSSPQPR GPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARA LELAGQANRKEEEAVEPQSSPAKNPSDEDLLRDLLIQELLACLLDQTNLC RLRSR
    • Molecular weight
      17 kDa including tags
    • Amino acids
      22 to 153
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156354 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Purity
    >90% by SDS-PAGE.
    ab156354 is purified using anion exchange chromatography (DEAE sepharose resin) and gel filtration chromatography (Sephacryl S-200) with 20 mM Tris pH 7.5, 2 mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.03% DTT, 0.32% Tris HCl, 50% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • Gastric Inhibitory Peptide
    • Gastric inhibitory polypeptide
    • Gastric inhibitory polypeptide precursor
    • GIP
    • GIP_HUMAN
    • Glucose dependent insulinotropic polypeptide
    • Glucose-dependent insulinotropic polypeptide
    • Incretin hormone
    see all
  • Function
    Potent stimulator of insulin secretion and relatively poor inhibitor of gastric acid secretion.
  • Sequence similarities
    Belongs to the glucagon family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab156354 (3 µg).

References

ab156354 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156354.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up