Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AKVTSGRETLRLRSGGAATVEEAPSEFEEEASRKVDDLLESYMGIRDPEL ASTMVETSKKTASAQEFARCLDSVLGEFAFPDEFVVEVWAAIGEAREAC
    • Amino acids
      213 to 311
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165251 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C19orf64
    • DFNB15
    • DFNB72
    • DFNB95
    • DKFZp686J1198
    • FLJ40925
    • GIPC 3
    • GIPC PDZ domain containing family member 3
    • PDZ domain containing protein GIPC 3
    • PDZ domain containing protein GIPC3
    • PDZ domain protein GIPC 3
    • PDZ domain protein GIPC3
    see all
  • Relevance
    GIPC3 is widely expressed in adult and fetal tissues. Highest levels are found in jejunum, lymph node, parietal lobe, fetal spleen and fetal thymus. It is expressed in cervical, melanoma, chronic myelogenous and gastric cancer cell lines.

Images

  • ab165251 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165251 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165251.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up