Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TDLETTASKTNRQKLQTLQSENSNLRKQATTNVYQVQTGSEYTDTSNHSS LKRRPSARGSRPMSMYETGSGQKPYLPMGEASRPEESRMRLQPFPAHA
    • Amino acids
      401 to 498
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160667 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARF GAP GIT2
    • ARF GTPase activating protein GIT2
    • ARF GTPase-activating protein GIT2
    • CAT 2
    • CAT-2
    • CAT2
    • Cool associated tyrosine phosphorylated protein 2
    • Cool interacting tyrosine phosphorylated protein 2
    • Cool-interacting tyrosine-phosphorylated protein 2
    • DKFZp686G01261
    • G protein coupled receptor kinase interacting ArfGAP 2
    • G protein coupled receptor kinase interactor 2
    • G protein-coupled receptor kinase-interactor 2
    • GIT 2
    • GIT2
    • GIT2_HUMAN
    • GRK interacting protein 2
    • GRK-interacting protein 2
    • KIAA0148
    • MGC760
    see all
  • Function
    GTPase-activating protein for the ADP ribosylation factor family.
  • Sequence similarities
    Contains 3 ANK repeats.
    Contains 1 Arf-GAP domain.
  • Information by UniProt

Images

  • ab160667 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160667 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160667.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up