Overview

  • Product name
    Recombinant Human GLDC protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAF PLPFMKPENKFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASS
    • Molecular weight
      37 kDa including tags
    • Amino acids
      922 to 1020

Specifications

Our Abpromise guarantee covers the use of ab116757 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • GCE
    • GCSP
    • GCSP_HUMAN
    • GLDC
    • Glycine cleavage system P protein
    • glycine cleavage system protein P
    • Glycine decarboxylase
    • glycine decarboxylase P protein
    • Glycine dehydrogenase (decarboxylating) mitochondrial
    • Glycine dehydrogenase [decarboxylating], mitochondrial
    • Gycine dehydrogenase (decarboxylating)
    • HYGN1
    • MGC138198
    • MGC138200
    • NKH
    see all
  • Function
    The glycine cleavage system catalyzes the degradation of glycine. The P protein binds the alpha-amino group of glycine through its pyridoxal phosphate cofactor; CO(2) is released and the remaining methylamine moiety is then transferred to the lipoamide cofactor of the H protein.
  • Involvement in disease
    Defects in GLDC are a cause of non-ketotic hyperglycinemia (NKH) [MIM:605899]; also known as glycine encephalopathy (GCE). NKH is an autosomal recessive disease characterized by accumulation of a large amount of glycine in body fluid and by severe neurological symptoms.
  • Sequence similarities
    Belongs to the gcvP family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Recombinant Human GLDC protein images

  • 12.5% SDS-PAGE analysis of ab116757 at approximately 36.52kDa, stained with Coomassie Blue.

References for Recombinant Human GLDC protein (ab116757)

ab116757 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116757.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up