Recombinant Human GLEPP1 protein (ab114815)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ16827
    • SpeciesHuman
    • SequenceMGHLPTGIHGARRLLPLLWLFVLFKNATAFHVTVQDDNNIVVSLEASDVI SPASVYVVKITGESKNYFFEFEEFNSTLPPPVIFKASYHGLYYIITLVVV NGNVVTKPSRSITVLTKPLPVTSVSIYDYKPSPETGVLFEIHYPEKYNVF TRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATF NKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNKNNWEEQSGNFPEE SFMRSQDTIGKEKLFHFTEETPEIPSGNISSGWPDFNSSDYETTSQPYWW DSASAAPESEDEFVSVLPMEYENNSTLSETEKSTSGSFSFFPVQMILTWL PPKPPTAFDGFHIHIEREENFTEYLMVDEEAHEFVAELKEPGKYKLSVTT FSSSGSCETRKSQSAKSLSFYISPSGEWIEELTEKPQHVSVHVLSSTTAL MSWTSSQENYNSTIVSVVSLTCQKQKESQRLEKQYCTQVNSSKPIIENLV PGAQYQVVIYLRKGPLIGPPSDPVTFAIVPTGIKDLMLYPLGPTAVVLSW TRPYLGVFRKYVVEMFYFNPATMTSEWTTYYEIAATVSLTASVVIFP
    • Molecular weight92 kDa including tags
    • Amino acids1 to 598

Specifications

Our Abpromise guarantee covers the use of ab114815 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FMI
    • GLEPP 1
    • Glomerular epithelial protein 1
    • hPTP-J
    • Pancreatic carcinoma phosphatase 2
    • PCP-2
    • PCP2
    • Phosphotyrosine phosphatase U2
    • Protein tyrosine phosphatase PTP U2
    • Protein tyrosine phosphatase PTPU2
    • Protein tyrosine phosphatase receptor type O
    • Protein tyrosine phosphatase U2
    • Protein-tyrosine phosphatase J
    • Protein-tyrosine phosphatase pi
    • Protein-tyrosine phosphatase receptor omicron
    • PTP pi
    • PTP U2
    • PTP-J
    • PTP-RO
    • PTP-U2
    • PTPase U2
    • PTPRO
    • PTPRO_HUMAN
    • PTPROt
    • PTPU 2
    • PTPU2
    • R-PTP-O
    • R-PTP-psi
    • Receptor type protein tyrosine phosphatase O
    • Receptor type tyrosine protein phosphatase O
    • Receptor-type protein-tyrosine phosphatase psi
    • Receptor-type tyrosine-protein phosphatase O
    • Receptor-type tyrosine-protein phosphatase U
    see all
  • FunctionPossesses tyrosine phosphatase activity.
  • Tissue specificityGlomerulus of kidney. Also detected in brain, lung and placenta.
  • Sequence similaritiesBelongs to the protein-tyrosine phosphatase family. Receptor class 3 subfamily.
    Contains 8 fibronectin type-III domains.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human GLEPP1 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human GLEPP1 protein (ab114815)

ab114815 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114815.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"