Recombinant Human Gliomedin protein (ab153642)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SRRAKGPRQPSMFNGQCPGETCAIPNDDTLVGKADEKASEHHSPQAESMI TSIGNPVQVLKVTETFGTWIRESANKSDDRIWVTEHFSGIMVKEFKDQPS LLNGSYTFIH
    • Amino acids
      131 to 240
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CANCER RELATED GENE LIVER 2
    • Cancer related gene-Liver 2
    • CLOM
    • collomin
    • COLM
    • Colm (gene name)
    • Colmedin
    • CRG L2
    • CRGL2
    • FLJ23917
    • Gldn (gene name)
    • UNC 112
    see all
  • Relevance
    Gliomedin is a member of the collagen superfamily, it is a glial ligand for neurofascin and NrCAM, two axonal immunoglobulin cell adhesion molecules that are associated with Na+ channels at the nodes of Ranvier. Gliomedin provides a glial cue for the formation of peripheral nodes of Ranvier. Gliomedin is expressed by myelinating Schwann cells and accumulates at the edges of each myelin segment during development, where it aligns with the forming nodes of ranvier. Eliminating the expression of gliomedin or the addition of a soluble extracellular domain of neurofascin to myelinating cultures abolishes node formation. Gliomedin is expressed in the PNS nodes of ranvier, but not in the CNS nodes of ranvier. Gliomedin also displays high expression in murine and human hepatocellular carcinomas (HCC). Its restricted expression in normal tissues and unique early upregulation during tumor development make it an excellent candidate as a new clinical marker of HCC.
  • Cellular localization
    Cell Membrane and Cytoplasmic

Images

  • ab153642 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153642 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153642.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up