Recombinant Human GLIPR1 protein (ab161239)

Overview

  • Product name
    Recombinant Human GLIPR1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWA SNCQFSHNTRLKPPHKLHPNFTSLGEN
    • Amino acids
      23 to 99
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161239 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CRISP 7
    • CRISP7
    • GLI pathogenesis related 1
    • GLI pathogenesis-related 1 (glioma)
    • Glioma pathogenesis related protein 1
    • Glioma pathogenesis-related protein 1
    • GLIP1_HUMAN
    • GLIPR
    • GliPR 1
    • GLIPR1
    • Protein RTVP-1
    • RELATED TO TESTIS SPECIFIC, VESPID, AND PATHOGENESIS PROTEINS 1
    • RTVP 1
    • RTVP1
    • Testes specific vespid and pathogenesis protein 1
    • testes-specific vespid and pathogenesis protein 1
    see all
  • Tissue specificity
    According to PubMed:8973356, it is ubiquitously expressed with high levels in lung and kidney and low levels in heart and liver. Highly expressed in cell lines derived from nervous system tumors arising from glia, low or absent in non-glial-derived nervous system tumor cell lines. Also found in fetal kidney. According to PubMed:7607567 it is expressed only in brain tumor glioblastoma multiforme/astrocytoma and not in other nervous system tumors or normal fetal or adult tissues.
  • Sequence similarities
    Belongs to the CRISP family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab161239 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161239 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161239.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up