Overview

  • Product name
    Recombinant Human GLIPR2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGKSASKQFHNEVLKAHNEYRQKHGVPPLK LCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWASYDQTGKEVA DRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVV ARYFPAGNVVNEGFFEENVLPPKK
    • Molecular weight
      19 kDa including tags
    • Amino acids
      1 to 154
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99564 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab99564 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 5730414A08Rik
    • C77180
    • C9orf19
    • GAPR 1
    • GAPR-1
    • GAPR1_HUMAN
    • GLI pathogenesis related 2
    • Glioma pathogenesis related protein 2
    • Glioma pathogenesis-related protein 2
    • GliPR 2
    • GLIPR2
    • Golgi associated plant pathogenesis related protein 1
    • Golgi associated PR 1 protein
    • Golgi-associated plant pathogenesis-related protein 1
    • Golgi-associated PR-1 protein
    • OTTMUSP00000007558
    • RP11-421H8.5
    • RP23-209M8.2
    see all
  • Tissue specificity
    Highest expression in lung and peripheral leukocytes, and minor expression in liver and kidney.
  • Sequence similarities
    Belongs to the CRISP family.
    Contains 1 SCP domain.
  • Cellular localization
    Golgi apparatus membrane. Binds lipid-enriched microdomains of Golgi membranes not only by ionic interactions but also through the myristate.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99564 (3µg).

References

ab99564 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99564.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up