Overview

  • Product nameRecombinant Human GLIPR2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9H4G4
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGKSASKQFHNEVLKAHNEYRQKHGVPPLK LCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWASYDQTGKEVA DRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVV ARYFPAGNVVNEGFFEENVLPPKK
    • Molecular weight19 kDa including tags
    • Amino acids1 to 154
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99564 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab99564 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 5730414A08Rik
    • C77180
    • C9orf19
    • GAPR 1
    • GAPR-1
    • GAPR1_HUMAN
    • GLI pathogenesis related 2
    • Glioma pathogenesis related protein 2
    • Glioma pathogenesis-related protein 2
    • GliPR 2
    • GLIPR2
    • Golgi associated plant pathogenesis related protein 1
    • Golgi associated PR 1 protein
    • Golgi-associated plant pathogenesis-related protein 1
    • Golgi-associated PR-1 protein
    • OTTMUSP00000007558
    • RP11-421H8.5
    • RP23-209M8.2
    see all
  • Tissue specificityHighest expression in lung and peripheral leukocytes, and minor expression in liver and kidney.
  • Sequence similaritiesBelongs to the CRISP family.
    Contains 1 SCP domain.
  • Cellular localizationGolgi apparatus membrane. Binds lipid-enriched microdomains of Golgi membranes not only by ionic interactions but also through the myristate.
  • Information by UniProt

Recombinant Human GLIPR2 protein images

  • 15% SDS-PAGE showing ab99564 (3µg).

References for Recombinant Human GLIPR2 protein (ab99564)

ab99564 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99564.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"