Overview

  • Product name
    Recombinant Human GliS2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MHSLDEPLDLKLSITKLRAAREKRERTLGVVRPRALHRELGLVDDSPTPG SPGSPPSGFLLNSKFPEKVEGRFSAAPLVDLSLSPPSGLDSPNGSSSLSP ERQGNGDLPPVPSASDFQPLRYLDGVPSSFQFFLPLGSGGALHLPASSFL TPPKDKCLSPDLPLPKQLVCRWAKCNQLFELLQDLVDHVNDYHVKPEKDA GYCCHWEGCARHGRGFNARYKMLIHIRTHTNEKPHRCPTCSKSFSRLENL KIHNRSHTGEKPYVCPYEGCNKRYSNSSDRFKHTRTHYVDKPYYCKMPGC HKRYTDPSSLRKHIKAHGHFVSHEQQELLQLRPPPKPPLPAPDGGPYVSG AQIIIPNPAALFGGPGLPGLPLPLAPGPLDLSALACGNGGGSGGGGGMGP GLPGPVLPLNLAKNPLLPSPFGAGGLGLPVVSLLAGAAGGKAEGEKGRGS VPTRALGMEGHKTPLERTESSCSRPSPDGLPLLPGTVLDLSTGVNSAASS PEALAPGWVVIPPGSVLLKPAVVN
    • Amino acids
      1 to 524
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153554 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ38247
    • GLI similar 2
    • GLI-similar 2
    • GLIS 2
    • GLIS family zinc finger 2
    • glis2
    • GLIS2_HUMAN
    • Kruppel like zinc finger protein GLIS2
    • Neuronal Krueppel-like protein
    • Zinc finger protein GLIS2
    see all
  • Function
    Can act either as a transcription repressor or as a transcription activator, depending on the cell context. Represses the transcriptional activation mediated by CTNNB1 in the Wnt pathway. May act by recruiting the corepressors CTBP1 and HDAC3. May be involved in neuron differentiation.
  • Tissue specificity
    Expressed at high levels in kidney and at low levels in heart, lung and placenta. Expressed in colon.
  • Involvement in disease
    Defects in GLIS2 are the cause of nephronophthisis type 7 (NPHP7) [MIM:611498]. NPHP7 is an autosomal recessive disorder resulting in end-stage renal disease during childhood or adolescence. It is a progressive tubulo-interstitial kidney disorder histologically characterized by modifications of the tubules with thickening of the basement membrane, interstitial fibrosis and, in the advanced stages, medullary cysts.
  • Sequence similarities
    Belongs to the GLI C2H2-type zinc-finger protein family.
    Contains 5 C2H2-type zinc fingers.
  • Domain
    The C2H2-type zinc finger 1 has a major repressor function and is required for CTNNB1 binding.
  • Post-translational
    modifications
    C-terminus cleavage is induced by interaction with CTNND1 and enhanced by Src tyrosine kinase.
  • Cellular localization
    Nucleus speckle. Cytoplasm.
  • Information by UniProt

Images

  • ab153554 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153554 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153554.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up