Overview

  • Product name
    Recombinant Human GLMN protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAVEELQSIIKRCQILEEQDFKEEDFGLFQLAGQRCIEEGHTDQLLEIIQ NEKNKVIIKNMGWNLVGPVVRCLLCKDKEDSKRKVYFLIFDLLVKLCNPK ELLLGLLELIEEPSGKQISQSILLLLQPLQTVIQKLHNKAYSIGLALSTL WNQLSLLPVPYSKEQIQMDDYGLCQCCKALIEFTKPFVEEVIDNKENSLE NEKLKDELLKFCFKSLKCPLLTAQFFEQSEEGGNDPFRYFASEIIGFLSA IGHPFPKMIFNHGRKKRTWNYLEFEEEENKQLADSMASLAYLVFVQGIHI DQLPMVLSPLYLLQFNMGHIEVFLQRTEESVISKGLELLENSLLRIEDNS LLYQYLEIKSFLTVPQGLVKVMTLCPIETLRKKSLAMLQLYINKLDSQGK YTLFRCLLNTSNHSGVEAFIIQNIKNQIDMSLKRTRNNKWFTGPQLISLL DLVLFLPEGAETDLLQNSDRIMASLNLLRYLVIKDNENDNQTGLWTELGN IENNFLKPLHIGLNMSKAHYEAEIKNSQEAQKSKDLCSITVSGEEIPNMP PEMQLKVLHSALFTFDLIESVLARVEELIEIKTKSTSEENIGIK
    • Amino acids
      1 to 594
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161321 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FAP
    • FAP48
    • FAP68
    • FK506 binding protein associated protein
    • FK506-binding protein-associated protein
    • FKBP associated protein
    • FKBP-associated protein
    • FKBP-associated protein, 48-KD
    • FKBP-associated protein, 68-KD
    • FKBPAP
    • GLML
    • Glmn
    • GLMN_HUMAN
    • Glomulin
    • glomulin, FKBP associated protein
    • GVM
    • VMGLOM
    see all
  • Function
    Essential for normal development of the vasculature. May represent a naturally occurring ligand of the immunophilins FKBP59 and FKBP12. May function as an membrane anchoring protein. Isoform 1 may stimulate the p70S6K pathway. Isoform 2 may inhibit cell proliferation and increase IL2 production.
  • Tissue specificity
    Ubiquitous.
  • Involvement in disease
    Glomuvenous malformations
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues.
  • Information by UniProt

Images

  • ab161321 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161321 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161321.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up