Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9HC38-2
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAARRALHFVFKVGNRFQTARFYRDVLGMK VLRHEEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGVGDY KLGNDFMGITLASSQAVSNARKLEWPLTEVAEGVFETEAPGGYKFYLQNR SLPQSDPVLKVTLAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADN QCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLV SLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEGSKLLDDAMA ADKSDEWFAKHNKPKASG
    • Molecular weight35 kDa including tags
    • Amino acids1 to 298
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109939 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab109939 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • C17orf25
    • CGI 150
    • Glod4
    • GLOD4_HUMAN
    • Glyoxalase domain containing 4
    • glyoxalase domain containing protein 4
    • Glyoxalase domain-containing protein 4
    • HC71
    • my027
    see all
  • Tissue specificityExpressed in heart, brain, liver, kidney, pancreas and placenta. Not expressed in skeletal muscle and lung.
  • Sequence similaritiesBelongs to the glyoxalase I family.
  • Cellular localizationMitochondrion.
  • Information by UniProt

Recombinant Human GLOD4 protein images

  • 15% SDS-PAGE analysis of 3µg ab109939.

References for Recombinant Human GLOD4 protein (ab109939)

ab109939 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109939.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"