Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMAARRALHFVFKVGNRFQTARFYRDVLGMKVLRHEEFEEGCKAACNGPYD GKWSK TMVGFGPEDDHFVAELTYNYGVGDYKLGNDFMGITLASSQAVS NARKLEWPLTEV AEGVFETEAPGGYKFYLQNRSLPQSDPVLKVTLAVS DLQKSLNYWCNLLGMKIYE KDEEKQRALLGYADNQCKLELQGVKGGVD HAAAFGRIAFSCPQKELPDLEDLMKR ENQKILTPLVSLDTPGKATVQV VILADPDGHEICFVGDEAFRELSKMDPEGSKLL DDAMSADKSDEWFAK HNKPKASG

Specifications

Our Abpromise guarantee covers the use of ab89012 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab89012 was purified using affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • C17orf25
    • CGI 150
    • Glod4
    • GLOD4_HUMAN
    • Glyoxalase domain containing 4
    • glyoxalase domain containing protein 4
    • Glyoxalase domain-containing protein 4
    • HC71
    • my027
    see all
  • Tissue specificityExpressed in heart, brain, liver, kidney, pancreas and placenta. Not expressed in skeletal muscle and lung.
  • Sequence similaritiesBelongs to the glyoxalase I family.
  • Cellular localizationMitochondrion.
  • Information by UniProt

References for Recombinant Human GLOD4 protein (ab89012)

ab89012 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab89012.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"