Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KVNPFAKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTLSETQAEAAAEA LSKENLESMV
    • Amino acids
      543 to 602
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153287 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • breast cell glutaminase
    • GA
    • GLS
    • Gls2
    • GLSL_HUMAN
    • glutaminase 2
    • glutaminase 2 (liver mitochondrial)
    • glutaminase GA
    • glutaminase I
    • Glutaminase liver isoform
    • Glutaminase liver isoform, mitochondrial
    • hLGA
    • L glutaminase
    • L glutamine amidohydrolase
    • L-glutaminase
    • L-glutamine amidohydrolase
    • LGA
    • mitochondrial
    • phosphate activated glutaminase
    • phosphate-dependent glutaminase
    see all
  • Function
    Plays an important role in the regulation of glutamine catabolism. Promotes mitochondrial respiration and increases ATP generation in cells by catalyzing the synthesis of glutamate and alpha-ketoglutarate. Increases cellular anti-oxidant function via NADH and glutathione production. May play a role in preventing tumor proliferation.
  • Tissue specificity
    Highly expressed in liver. Expressed in brain and pancreas. Not observed in heart, placenta, lung, skeletal muscle and kidney. Expression is significantly reduced in hepatocellular carcinomas.
  • Sequence similarities
    Belongs to the glutaminase family.
    Contains 2 ANK repeats.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab153287 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153287 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153287.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up