Recombinant Human glucose-6-phosphatase, catalytic subunit protein (ab114563)

Overview

  • Product name
    Recombinant Human glucose-6-phosphatase, catalytic subunit protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIW FHLQEAVGIKLLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVP LIKQFPVTCETGPGSPSGHAMGTAGVYYVMVTSTLSIFQGKIKPTYRFRC LNVILWLGFWAVQLNVCLSRIYLAAHFPHQVVAGVLSGIAVAETFSHIHS IYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEKAQRWCEQPEW VHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWLPFRLSSIV ASLVLLHVFDSLKPPSQVELVFYVLSFCKSAVVPLASVSVIPYCLAQVLG QPHKKSL
    • Molecular weight
      65 kDa including tags
    • Amino acids
      1 to 357

Specifications

Our Abpromise guarantee covers the use of ab114563 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AW107337
    • G-6-Pase
    • G6Pase
    • G6Pase-alpha
    • g6pc
    • G6PC_HUMAN
    • G6PT
    • Glucose-6-phosphatase
    • Glucose-6-phosphatase alpha
    • GSD1
    • GSD1a
    • MGC163350
    • MGC93613
    • RP23-281C18.19
    see all
  • Function
    Hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. Forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels.
  • Pathway
    Carbohydrate biosynthesis; gluconeogenesis.
  • Involvement in disease
    Defects in G6PC are the cause of glycogen storage disease type 1A (GSD1A) [MIM:232200]. A metabolic disorder characterized by impairment of terminal steps of glycogenolysis and gluconeogenesis. Patients manifest a wide range of clinical symptoms and biochemical abnormalities, including hypoglycemia, severe hepatomegaly due to excessive accumulation of glycogen, kidney enlargement, growth retardation, lactic acidemia, hyperlipidemia, and hyperuricemia.
  • Sequence similarities
    Belongs to the glucose-6-phosphatase family.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human glucose-6-phosphatase, catalytic subunit protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human glucose-6-phosphatase, catalytic subunit protein (ab114563)

ab114563 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114563.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up