Recombinant Human Glucose Transporter 5 GLUT5 protein (ab152682)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFY NETYYGRTGEFMEDFPLTLLWSVTVSMFPFGGFIGSLLVGPLVNKFGRKG ALLFNNIFSIVPAILMGCSRVATSFELIIISRLLVGICAGVSSNVVPMYL GELAPKNLRGALGVVPQLFITVGILVAQIFGLRNLLANVDGWPILLGLTG VPAALQLLLLPFFPESPRYLLIQKKDEAAAKKALQTLRGWDSVDREVAEI RQEDEAEKAAGFISVLKLFRMRSLRWQLLSIIVLMGGQQLSGVNAIYYYA DQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGFS ICLIACCVLTAALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLIT EIFLQSSRPSAFMVGGSVHWLSNFTVGLIFPFIQEGLGPYSFIVFAVICL LTTIYIFLIVPETKAKTFIEINQIFTKMNKVSEVYPEKEELKELPPVTSE Q
    • Molecular weight
      81 kDa including tags
    • Amino acids
      1 to 501

Specifications

Our Abpromise guarantee covers the use of ab152682 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.Best use within three months from the date of receipt of this protein.

    Boiling treatment may cause the aggregation of membrane protein in the stacking gels, results in the failure to detect the membrane protein in the separating gels.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Facilitated glucose transporter member 5
    • Fructose transporter
    • Glucose transporte, kidney
    • glucose transporter like protein 5
    • Glucose transporter type 5
    • Glucose transporter type 5 small intestine
    • GLUT 5
    • GLUT-5
    • GLUT5
    • GTR5_HUMAN
    • SLC 2A5
    • SLC2A5
    • small intestine
    • Solute carrier family 2
    • solute carrier family 2 (facilitated glucose/fructose transporter), member 5
    see all
  • Function
    Cytochalasin B-sensitive carrier. Seems to function primarily as a fructose transporter.
  • Tissue specificity
    Expressed in small intestine, and at much lower levels in kidney, skeletal muscle, and adipose tissue.
  • Sequence similarities
    Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152682 stained with Coomassie Blue.

References

ab152682 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152682.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up