Recombinant Human Glucose Transporter GLUT3 protein (ab114242)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFR V
    • Molecular weight
      31 kDa including tags
    • Amino acids
      213 to 263

Specifications

Our Abpromise guarantee covers the use of ab114242 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • brain
    • FLJ90380
    • Glucose transporter type 3
    • Glucose transporter type 3 brain
    • GLUT 3
    • GLUT-3
    • GLUT3
    • GTR3_HUMAN
    • Slc2a3
    • Solute Carrier Family 2 (Facilitated Glucose Transporter) Member 3
    • Solute carrier family 2, facilitated glucose transporter member 3
    see all
  • Function
    Facilitative glucose transporter. Probably a neuronal glucose transporter.
  • Tissue specificity
    Highly expressed in brain. Expressed in many tissues.
  • Sequence similarities
    Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human Glucose Transporter GLUT3 protein images

  • 12.5% SDS-PAGE showing ab114242 at approximately 31.24kDa stained with Coomassie Blue.

References for Recombinant Human Glucose Transporter GLUT3 protein (ab114242)

ab114242 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114242.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up