Recombinant Human Glucose Transporter GLUT3 protein (ab114242)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFR V
    • Molecular weight
      31 kDa including tags
    • Amino acids
      213 to 263

Specifications

Our Abpromise guarantee covers the use of ab114242 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • brain
    • FLJ90380
    • Glucose transporter type 3
    • Glucose transporter type 3 brain
    • GLUT 3
    • GLUT-3
    • GLUT3
    • GTR3_HUMAN
    • Slc2a3
    • Solute Carrier Family 2 (Facilitated Glucose Transporter) Member 3
    • Solute carrier family 2, facilitated glucose transporter member 3
    see all
  • Function
    Facilitative glucose transporter. Probably a neuronal glucose transporter.
  • Tissue specificity
    Highly expressed in brain. Expressed in many tissues.
  • Sequence similarities
    Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114242 at approximately 31.24kDa stained with Coomassie Blue.

References

ab114242 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114242.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up