Recombinant Human Glucose Transporter GLUT4 protein (ab114176)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND
    • Molecular weight
      30 kDa including tags
    • Amino acids
      467 to 509

Specifications

Our Abpromise guarantee covers the use of ab114176 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Glucose transporter GLUT 4
    • Glucose transporter type 4
    • Glucose transporter type 4 insulin responsive
    • GLUT 4
    • GLUT-4
    • GLUT4
    • GTR4_HUMAN
    • Insulin responsive glucose transporter type 4
    • insulin-responsive
    • kug
    • SLC 2A4
    • SLC2A4
    • solute carrier family 2 (facilitated glucose transporter) member 4
    • Solute carrier family 2 member 4
    • Solute carrier family 2, facilitated glucose transporter member 4
    see all
  • Function
    Insulin-regulated facilitative glucose transporter.
  • Tissue specificity
    Skeletal and cardiac muscles; brown and white fat.
  • Involvement in disease
    Diabetes mellitus, non-insulin-dependent
  • Sequence similarities
    Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
  • Post-translational
    modifications
    Sumoylated.
  • Cellular localization
    Cell membrane. Endomembrane system. Cytoplasm, perinuclear region. Localizes primarily to the perinuclear region, undergoing continued recycling to the plasma membrane where it is rapidly reinternalized. The dileucine internalization motif is critical for intracellular sequestration.
  • Information by UniProt

Recombinant Human Glucose Transporter GLUT4 protein images

  • ab114176 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human Glucose Transporter GLUT4 protein (ab114176)

ab114176 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114176.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up