Recombinant Human Glucosidase 2 subunit beta protein (ab159211)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ISFDFGPNGEFAYLYSQCYELTTNEYVYRLCPFKLVSQKPKLGGSPTSLG TWGSWIGPDHDKFSAMKYEQGTGCWQGPNRSTTVRLLCGKETMVTSTTEP SRCEYLMELM
    • Amino acids
      268 to 377
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159211 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 80K-H protein
    • AGE-binding receptor 2
    • AGE-R2
    • G19P1
    • GLU2B_HUMAN
    • Glucosidase 2 subunit beta
    • Glucosidase II beta subunit
    • Glucosidase II subunit beta
    • Hepatocystin
    • PCLD
    • PKCSH
    • PLD1
    • PRKCSH
    • Protein kinase C substrate 60.1 kDa protein heavy chain
    • Protein kinase C substrate 80 Kda protein
    • Protein kinase C substrate 80K-H
    • Protein kinase C substrate, 80 Kda protein
    see all
  • Function
    Regulatory subunit of glucosidase II.
  • Pathway
    Glycan metabolism; N-glycan metabolism.
  • Involvement in disease
    Defects in PRKCSH are a cause of polycystic liver disease (PCLD) [MIM:174050]. PCLD is an autosomal dominant disorder and is characterized by the presence of multiple liver cysts of biliary epithelial origin. PCLD is a distinct clinical and genetic entity that can occur independently from autosomal dominant polycystic kidney disease (ADPKD) [MIM:173900], which in a considerable but uncertain proportion of cases is associated with hepatic cysts.
  • Sequence similarities
    Contains 2 EF-hand domains.
    Contains 1 PRKCSH domain.
  • Cellular localization
    Endoplasmic reticulum.
  • Information by UniProt

Images

  • ab159211 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159211 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159211.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up