Recombinant Human Glutamate Receptor 1 (AMPA subtype) protein (ab112297)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANV TGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
    • Molecular weight
      37 kDa including tags
    • Amino acids
      201 to 300
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112297 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • GLUR 1
    • GLUR A
    • AMPA 1
    • AMPA selective glutamate receptor 1
    • AMPA-selective glutamate receptor 1
    • GluA1
    • GLUH1
    • GluR K1
    • GluR-1
    • GluR-A
    • GluR-K1
    • GLUR1
    • GLURA
    • GluRK1
    • Glutamate receptor 1
    • Glutamate receptor ionotropic
    • Glutamate receptor ionotropic AMPA 1
    • Glutamate receptor, ionotropic, AMPA 1
    • Gria1
    • GRIA1_HUMAN
    • HBGR1
    • MGC133252
    • OTTHUMP00000160643
    • OTTHUMP00000165781
    • OTTHUMP00000224241
    • OTTHUMP00000224242
    • OTTHUMP00000224243
    see all
  • Function
    Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist.
  • Tissue specificity
    Widely expressed in brain.
  • Sequence similarities
    Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIA1 subfamily.
  • Post-translational
    modifications
    Palmitoylated. Depalmitoylated upon glutamate stimulation. Cys-603 palmitoylation leads to Golgi retention and decreased cell surface expression. In contrast, Cys-829 palmitoylation does not affect cell surface expression but regulates stimulation-dependent endocytosis.
  • Cellular localization
    Cell membrane. Endoplasmic reticulum membrane. Cell junction > synapse > postsynaptic cell membrane. Interaction with CACNG2 promotes cell surface expression.
  • Information by UniProt

Images

  • ab112297 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab112297 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112297.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up