Recombinant Human Glutamate receptor 3 protein (ab114562)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SLLGHYKWEKFVYLYDTERGFSILQAIMEAAVQNNWQVTARSVGNIKDVQ EFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHSRGYHYMLANL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      151 to 250

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114562 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AMPA 3
    • AMPA selective glutamate receptor 3
    • AMPA-selective glutamate receptor 3
    • dJ1171F9.1
    • GluA3
    • GLUK3
    • GluR 3
    • GLUR C
    • GLUR K3
    • GluR-3
    • GluR-C
    • GluR-K3
    • GLUR3
    • GLURC
    • Glutamate ionotropic receptor AMPA type subunit 3
    • Glutamate receptor 3
    • Glutamate receptor C
    • Glutamate receptor ionotrophic AMPA 3
    • Glutamate receptor ionotropic
    • Glutamate receptor subunit 3
    • Glutamate receptor, ionotropic, AMPA 3
    • GRIA 3
    • Gria3
    • GRIA3_HUMAN
    • Ionotrophic Glutamate Receptor
    • MRX94
    see all
  • Function
    Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist.
  • Involvement in disease
    Defects in GRIA3 are the cause of mental retardation X-linked type 94 (MRX94) [MIM:300699]. Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. MRX94 patients have moderate mental retardation. Other variable features are macrocephaly, seizures, myoclonic jerks, autistic behavior, asthenic body habitus, distal muscle weakness and hyporeflexia.
  • Sequence similarities
    Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIA3 subfamily.
  • Post-translational
    modifications
    Palmitoylated. Depalmitoylated upon glutamate stimulation. Cys-621 palmitoylation leads to Golgi retention and decreased cell surface expression. In contrast, Cys-847 palmitoylation does not affect cell surface expression but regulates stimulation-dependent endocytosis.
  • Cellular localization
    Cell membrane. Cell junction > synapse > postsynaptic cell membrane.
  • Information by UniProt

Recombinant Human Glutamate receptor 3 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human Glutamate receptor 3 protein (ab114562)

ab114562 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114562.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up