Recombinant Human Glutaminase protein (ab152430)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALH FGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL
    • Molecular weight
      36 kDa including tags
    • Amino acids
      580 to 669

Specifications

Our Abpromise guarantee covers the use of ab152430 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AAD20
    • DKFZp686O15119
    • FLJ10358
    • GAC
    • GAM
    • GLS
    • GLS1
    • GLSK_HUMAN
    • Glutaminase C
    • Glutaminase kidney isoform
    • Glutaminase phosphate activated
    • K-glutaminase
    • KGA
    • KIAA0838
    • L-glutamine amidohydrolase
    • mitochondrial
    see all
  • Function
    Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine.
  • Tissue specificity
    KGA is expressed predominantly in brain and kidney but not in liver, isoform 3 is expressed principally in cardiac muscle and pancreas but not in liver or brain, and isoform 2 is expressed solely in cardiac and skeletal muscle.
  • Sequence similarities
    Belongs to the glutaminase family.
    Contains 1 ANK repeat.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152430 stained with Coomassie Blue.

References

ab152430 has not yet been referenced specifically in any publications.

Customer reviews and Q&As



Unfortunately this protein has not been tested for its functionality or activity.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up