Recombinant Human Glutathione Peroxidase 1 protein (ab113603)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP07203
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMCAARLAAAAAAAQSVYAFSARPLAGGEPV SLGSLRGKVLLIENVASLCGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQ FGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLR EALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYS RRFQTIDIEPDIEALLSQGPSCA
    • Molecular weight24 kDa including tags
    • Amino acids1 to 203
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113603 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab113603 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 30% Glycerol, 0.04% DTT, 0.58% Sodium chloride

General Info

  • Alternative names
    • AL033363
    • Cellular glutathione peroxidase
    • Glutathione peroxidase
    • Glutathione peroxidase 1
    • GPx 1
    • GPx-1
    • GPX1
    • GPX1_HUMAN
    • GPXD
    • GSHPx-1
    • GSHPX1
    • MGC14399
    • MGC88245
    see all
  • FunctionProtects the hemoglobin in erythrocytes from oxidative breakdown.
  • Sequence similaritiesBelongs to the glutathione peroxidase family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human Glutathione Peroxidase 1 protein images

  • 15% SDS-PAGE showing ab113603 (3 µg) at approximately 24.2 kDa.

References for Recombinant Human Glutathione Peroxidase 1 protein (ab113603)

ab113603 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113603.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"