Recombinant Human Glutathione Peroxidase 1 protein (ab113603)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMCAARLAAAAAAAQSVYAFSARPLAGGEPV SLGSLRGKVLLIENVASLCGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQ FGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLR EALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYS RRFQTIDIEPDIEALLSQGPSCA
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 203
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113603 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113603 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 30% Glycerol, 0.04% DTT, 0.58% Sodium chloride

General Info

  • Alternative names
    • AL033363
    • Cellular glutathione peroxidase
    • Glutathione peroxidase
    • Glutathione peroxidase 1
    • GPx 1
    • GPx-1
    • GPX1
    • GPX1_HUMAN
    • GPXD
    • GSHPx-1
    • GSHPX1
    • MGC14399
    • MGC88245
    see all
  • Function
    Protects the hemoglobin in erythrocytes from oxidative breakdown.
  • Sequence similarities
    Belongs to the glutathione peroxidase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab113603 (3 µg) at approximately 24.2 kDa.

References

ab113603 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113603.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up