Recombinant Human Glutathione Peroxidase 7 protein (ab117062)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLV VNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEI ESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVA PDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL
    • Molecular weight
      47 kDa including tags
    • Amino acids
      1 to 187

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117062 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CL683
    • FLJ14777
    • Glutathione peroxidase 7
    • GPx-7
    • GPX6
    • GPX7
    • GPX7_HUMAN
    • GSHPx-7
    • NPGPx
    see all
  • Sequence similarities
    Belongs to the glutathione peroxidase family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human Glutathione Peroxidase 7 protein images

  • 12.5% SDS-PAGE showing ab117062 at approximately 46.64 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Glutathione Peroxidase 7 protein (ab117062)

ab117062 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117062.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up