Recombinant Human Glutathione S Transferase theta 2 protein (ab116911)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      WLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWR GRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP
    • Molecular weight
      37 kDa including tags
    • Amino acids
      145 to 244

Specifications

Our Abpromise guarantee covers the use of ab116911 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI266894
    • EC 2.5.1.18
    • Glutathione S transferase 12
    • Glutathione S transferase Yrs Yrs
    • Glutathione S-transferase theta-2
    • Glutathione S-transferase theta-2B
    • GST 12 12
    • GST class theta 2
    • GST class-theta-2
    • GST T2
    • GSTT 2
    • GSTT2
    • GSTT2 protein
    • GSTT2_HUMAN
    • GSTT2B
    • GSTT2P
    • MGC182032
    • mGSTT2
    • OTTHUMP00000198491
    • OTTHUMP00000198492
    • Yrs
    see all
  • Function
    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has a sulfatase activity.
  • Tissue specificity
    Expressed at low levels in liver. In lung, expressed at low levels in ciliated bronchiolar cells, alveolar macrophages and alveolar type II cells.
  • Sequence similarities
    Belongs to the GST superfamily. Theta family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116911 at approximately 36.63 kDa.

References

ab116911 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116911.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up