Recombinant Human Glutathione Synthetase protein (BSA and azide free) (ab172161)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MATNWGSLLQDKQQLEELARQAVDRALAEGVLLRTSQEPTSSEVVSYAPF TLFPSLVPSALLEQAYAVQMDFNLLVDAVSQNAAFLEQTLSSTIKQDDFT ARLFDIHKQVLKEGIAQTVFLGLNRSDYMFQRSADGSPALKQIEINTISA SFGGLASRTPAVHRHVLSVLSKTKEAGKILSNNPSKGLALGIAKAWELYG SPNALVLLIAQEKERNIFDQRAIENELLARNIHVIRRTFEDISEKGSLDQ DRRLFVDGQEIAVVYFRDGYMPRQYSLQNWEARLLLERSHAAKCPDIATQ LAGTKKVQQELSRPGMLEMLLPGQPEAVARLRATFAGLYSLDVGEEGDQA IAEALAAPSRFVLKPQREGGGNNLYGEEMVQALKQLKDSEERASYILMEK IEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLR TKAIEHADGGVAAGVAVLDNPYPVLEHHHHHH
    • Molecular weight
      54 kDa including tags
    • Amino acids
      2 to 474
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172161 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.32% Tris HCl, 1.17% Sodium chloride

General Info

  • Alternative names
    • epididymis secretory sperm binding protein Li 64p
    • epididymis secretory sperm binding protein Li 88n
    • Glutathione synthase
    • Glutathione synthetase
    • GSH S
    • GSH synthetase
    • GSH-S
    • GSHB_HUMAN
    • GSHS
    • GSS
    • HEL-S-64p
    • HEL-S-88n
    • MGC14098
    • OTTHUMP00000030711
    see all
  • Pathway
    Sulfur metabolism; glutathione biosynthesis; glutathione from L-cysteine and L-glutamate: step 2/2.
  • Involvement in disease
    Defects in GSS are the cause of glutathione synthetase deficiency (GSS deficiency) [MIM:266130]; also known as 5-oxoprolinuria or pyroglutamic aciduria. It is a severe form characterized by an increased rate of hemolysis and defective function of the central nervous system.
    Defects in GSS are the cause of glutathione synthetase deficiency of erythrocytes (GLUSYNDE)[MIM:231900]. Glutathione synthetase deficiency of erythrocytes is a mild form causing hemolytic anemia.
  • Sequence similarities
    Belongs to the eukaryotic GSH synthase family.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab172161.

    Lane 1: Reduced

    Lane 2: Non-Reduced

References

ab172161 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172161.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up