Recombinant Human Glutathione Transferase zeta 1 protein (ab172170)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF QALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVR MISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTA GIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQ VSHPCRQPDTPTELRALEHHHHHH
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 216
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172170 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.79% Tris HCl, 0.02% DTT

General Info

  • Alternative names
    • EC 2.5.1.18
    • EC 5.2.1.2
    • Glutathione S transferase zeta 1
    • Glutathione S-transferase zeta 1
    • Gstz1
    • GSTZ1-1
    • MAAI
    • MAAI_HUMAN
    • Maleylacetoacetate isomerase
    see all
  • Function
    Bifunctional enzyme showing minimal glutathione-conjugating activity with ethacrynic acid and 7-chloro-4-nitrobenz-2-oxa-1,3-diazole and maleylacetoacetate isomerase activity. Has also low glutathione peroxidase activity with T-butyl and cumene hydroperoxides. Is able to catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid.
  • Tissue specificity
    Mostly expressed in liver followed by kidney, skeletal muscle and brain. Also expressed in melanocytes, synovium, placenta, breast and fetal liver and heart.
  • Pathway
    Amino-acid degradation; L-phenylalanine degradation; acetoacetate and fumarate from L-phenylalanine: step 5/6.
  • Sequence similarities
    Belongs to the GST superfamily. Zeta family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE gel of ab172170 under non reduced (lane 1) and reduced (lane 2) conditions.

References

ab172170 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172170.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up