Overview

  • Product name
    Recombinant Human GLYAT protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMMLPLQGAQMLQMLEKSLRKSLPASLKVYG TVFHINHGNPFNLKAVVDKWPDFNTVVVCPQEQDMTDDLDHYTNTYQIYS KDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQ RILYMAAETAKELTPFLLKSKILSPSGGKPKAINQEMFKLSSMDVTHAHL VNKFWHFGGNERSQRFIERCIQTFPTCCLLGPEGTPVCWDLMDQTGEMRM AGTLPEYRLHGLVTYVIYSHAQKLGKLGFPVYSHVDYSNEAMQKMSYTLQ HVPIPRSWNQWNCVPL
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 296
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109928 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab109928 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 20% Glycerol

General Info

  • Alternative names
    • AAc
    • ACGNAT
    • Acyl CoA:glycine N acyltransferase
    • Acyl-CoA:glycine N-acyltransferase
    • Aralkyl acyl CoA N acyltransferase
    • Aralkyl acyl CoA:amino acid N acyltransferase
    • Aralkyl acyl-CoA N-acyltransferase
    • Aralkyl acyl-CoA:amino acid N-acyltransferase
    • Aralkyl CoA N acyltransferase
    • CAT
    • GAT
    • GLYAT
    • GLYAT_HUMAN
    • Glycine N acyltransferase
    • Glycine N benzoyltransferase
    • Glycine N-acyltransferase
    • HRP 1(CLP)
    • HRP-1(CLP)
    • OTTHUMP00000235930
    • OTTHUMP00000235931
    • OTTHUMP00000235932
    see all
  • Function
    Mitochondrial acyltransferase which transfers the acyl group to the N-terminus of glycine. Can conjugate a multitude of substrates to form a variety of N-acylglycines.
  • Sequence similarities
    Belongs to the glycine N-acyltransferase family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Recombinant Human GLYAT protein images

  • 15% SDS-PAGE showing ab109928 at approximately 36.0 kDa (3µg).

References for Recombinant Human GLYAT protein (ab109928)

ab109928 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109928.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up