Recombinant Human Glycerol 3 Phosphate Dehydrogenase protein (ab153790)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLT EIINTQHENVKYLPGHKLPPNVVAVPDVVQAAEDADILIFVVPHQFIGKI CDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERLGIPMSVLMGAN IASEVADEKFCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVDTVEICG ALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLFCSGPVSSAT FLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGPE TARELYSILQHKGLVDKFPLFMAVYKVCYEGQPVGEFIHCLQNHPEHMHH HHHH
    • Molecular weight
      38 kDa
    • Amino acids
      2 to 349
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153790 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Supplied as a 0.2 µM filtered solution.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • AI747587
    • cytoplasmic
    • EC 1.1.1.8
    • FLJ26652
    • G3PD
    • Gdc-1
    • Gdc1
    • Gdp1
    • Glycerol 3 phosphate dehydrogenase 1
    • Glycerol 3 phosphate dehydrogenase cytosolic
    • Glycerol 3 phosphate dehydrogenase soluble
    • Glycerol-3-phosphate dehydrogenase
    • Glycerol-3-phosphate dehydrogenase [NAD+]
    • Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic
    • Glycerol-3-phosphate dehydrogenase 1 (soluble)
    • Glycerol-3-phosphate dehydrogenase, soluble
    • Glycerphosphate dehydrogenase
    • GPD-C
    • gpd1
    • Gpd1 protein
    • Gpd3
    • GPDA_HUMAN
    • Gpdc
    • GPDH
    • GPDH-C
    • Gpdhc
    • HTGTI
    • KIAA4010
    • MGC93453
    • MGPD
    • mKIAA4010
    see all
  • Sequence similarities
    Belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab153790 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153790.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up