Recombinant Human Glycerol kinase protein (ab114846)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREG WVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQR
    • Molecular weight
      36 kDa including tags
    • Amino acids
      2 to 94

Specifications

Our Abpromise guarantee covers the use of ab114846 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP glycerol 3 phosphotransferase
    • ATP:glycerol 3 phosphotransferase
    • ATP:glycerol 3-phosphotransferase
    • D930012N15Rik
    • GK
    • GK1
    • GKD
    • GLPK_HUMAN
    • Glycerokinase
    • Glycerol kinase
    • OTTHUMP00000023108
    • OTTHUMP00000023109
    • OTTHUMP00000215321
    see all
  • Function
    Key enzyme in the regulation of glycerol uptake and metabolism.
  • Tissue specificity
    Highly expressed in the liver, kidney and testis. Isoform 2 and isoform 3 are expressed specifically in testis and fetal liver, but not in the adult liver.
  • Pathway
    Polyol metabolism; glycerol degradation via glycerol kinase pathway; sn-glycerol 3-phosphate from glycerol: step 1/1.
  • Involvement in disease
    Defects in GK are the cause of GK deficiency (GKD) [MIM:307030]. This disease can be either symptomatic with episodic metabolic and CNS decompensation or asymptomatic with hyperglycerolemia and hyperglyceroluria only.
  • Sequence similarities
    Belongs to the FGGY kinase family.
  • Cellular localization
    Mitochondrion outer membrane. Cytoplasm. In sperm and fetal tissues, the majority of the enzyme is bound to mitochondria, but in adult tissues, such as liver found in the cytoplasm.
  • Information by UniProt

Images

  • ab114846 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab114846 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114846.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up