Recombinant Human Glycogen synthase 2 protein (ab152447)

Overview

  • Product name
    Recombinant Human Glycogen synthase 2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLRGRSLSVTSLGGLPQWEVEELPVEELLLFEVAWEVTNKVGGIYTVIQT KAKTTADEWGENYFLIGPYFEHNMKTQVEQCEPVNDAVRRAVDAMNKHGC
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 100

Specifications

Our Abpromise guarantee covers the use of ab152447 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 ug/ul
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 2.4.1.11
    • Glycogen [starch] synthase
    • Glycogen starch synthase liver
    • Glycogen synthase 2 liver
    • Gys2
    • GYS2_HUMAN
    • liver
    see all
  • Function
    Transfers the glycosyl residue from UDP-Glc to the non-reducing end of alpha-1,4-glucan.
  • Pathway
    Glycan biosynthesis; glycogen biosynthesis.
  • Involvement in disease
    Defects in GYS2 are the cause of glycogen storage disease type 0 (GSD0) [MIM:240600]; A metabolic disorder characterized by fasting hypoglycemia presenting in infancy or early childhood, high blood ketones and low alanine and lactate concentrations. Although feeding relieves symptoms, it often results in postprandial hyperglycemia and hyperlactatemia.
  • Sequence similarities
    Belongs to the glycosyltransferase 3 family.
  • Post-translational
    modifications
    Primed phosphorylation at Ser-657 (site 5) by CSNK2A1 and CSNK2A2 is required for inhibitory phosphorylation at Ser-641 (site 3a), Ser-645 (site 3b), Ser-649 (site 3c) and Ser-653 (site 4) by GSK3A an GSK3B. Dephosphorylation at Ser-641 and Ser-645 by PP1 activates the enzyme.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152447 stained with Coomassie Blue.

References

ab152447 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152447.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up