Recombinant Human GLYCTK protein (ab165359)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VLSAAMQGDVKSMAQFYGLLAHVARTRLTPSMAGASVEEDAQLHELAAEL QIPDLQLEEALETMAWGRGPVCLLAGGEPTVQLQGSGRGGRNQELALRV
    • Amino acids
      332 to 430
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165359 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CG9886 like
    • GLCTK_HUMAN
    • Glycerate kinase
    • Glyctk
    • GLYCTK1
    • HBeAg binding protein 2
    • HBeAg binding protein 4
    • HBeAg-binding protein 4
    • HBeAgBP4A
    • HBEBP2
    • HBEBP4
    see all
  • Tissue specificity
    Widely expressed.
  • Involvement in disease
    Defects in GLYCTK are the cause of D-glyceric aciduria (D-GA) [MIM:220120]. D-GA is a rare metabolic disease characterized by chronic metabolic acidosis and a highly variable clinical phenotype. Clinical features range from an encephalopathic presentation with seizures, microcephaly, severe mental retardation and early death, to milder manifestations with only speech delay or even normal development.
  • Sequence similarities
    Belongs to the glycerate kinase type-2 family.
  • Cellular localization
    Cytoplasm and Cytoplasm. Mitochondrion.
  • Information by UniProt

Images

  • ab165359 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165359 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165359.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up