Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLVLHNSQKLQILYKSLEKSIPESIKVYGAIFNIKDKNPFNMEVLVDAWP DYQIVITRPQKQEMKDDQDHYTNTYHIFTKASDKLEEVLSYSNVISWEQT LQIQGCQEGLDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKME LFEVDDDNKKGNFSNMFIDASHAGLVNEHWAFGKNERSLKYIERCLQDFL GFGVLGPEGQLVSWIVMEQSCELRMGYTVPKYRHQGNMLQIGYHLEKYLS QKEIPFYFHVADNNEKSLQALNNLGFKICPCGWHQWKCTPKKYC
    • Amino acids
      1 to 294
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Acyl CoA glycine N acyltransferase like protein 2
    • Acyl CoA:glycine N acyltransferase like protein 2
    • BXMAS2 10
    • GATF B
    • GLYATL2
    • glycine acyltransferase family B
    • glycine N acyltransferase like 2
    • Glycine N acyltransferase like protein 2
    see all
  • Relevance
    GLYL2 belongs to the glycine N acyltransferase family, and is a mitochondrial acyltransferase which transfers the acyl group to the N terminus of glycine. It can conjugate a multitude of substrates to form a variety of N acylglycines.
  • Cellular localization
    Mitochondrial

Images

  • ab165940 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165940 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up