Recombinant Human Glypican 1/ GPC1 protein (ab114484)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCTSEM EENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQ ATFPGAFG
    • Molecular weight
      38 kDa including tags
    • Amino acids
      24 to 131

Specifications

Our Abpromise guarantee covers the use of ab114484 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ38078
    • glypican
    • Glypican proteoglycan 1
    • glypican1
    • GPC 1
    • Gpc1
    • GPC1_HUMAN
    • Secreted glypican-1
    see all
  • Function
    Cell surface proteoglycan that bears heparan sulfate.
  • Sequence similarities
    Belongs to the glypican family.
  • Post-translational
    modifications
    This cell-associated glypican is further processed to give rise to a medium-released species.
  • Cellular localization
    Cell membrane and Secreted > extracellular space.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114484 at approximately 37.51kDa stained with Coomassie Blue.

References

ab114484 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114484.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up