Recombinant Human Glypican 1/ GPC1 protein (ab114484)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCTSEM EENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQ ATFPGAFG
    • Molecular weight
      38 kDa including tags
    • Amino acids
      24 to 131

Specifications

Our Abpromise guarantee covers the use of ab114484 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ38078
    • glypican
    • Glypican proteoglycan 1
    • glypican1
    • GPC 1
    • Gpc1
    • GPC1_HUMAN
    • Secreted glypican-1
    see all
  • Function
    Cell surface proteoglycan that bears heparan sulfate.
  • Sequence similarities
    Belongs to the glypican family.
  • Post-translational
    modifications
    This cell-associated glypican is further processed to give rise to a medium-released species.
  • Cellular localization
    Cell membrane and Secreted > extracellular space.
  • Information by UniProt

Recombinant Human Glypican 1/ GPC1 protein images

  • 12.5% SDS-PAGE showing ab114484 at approximately 37.51kDa stained with Coomassie Blue.

References for Recombinant Human Glypican 1/ GPC1 protein (ab114484)

ab114484 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114484.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up