Recombinant Human Glypican 3 protein (ab114311)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      HAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNEL FDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVS
    • Molecular weight
      37 kDa including tags
    • Amino acids
      121 to 220

Specifications

Our Abpromise guarantee covers the use of ab114311 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • DGSX
    • Glypican proteoglycan 3
    • Glypican-3 [Precursor]
    • Gpc3
    • GPC3_HUMAN
    • GTR2 2
    • GTR2-2
    • Heparan sulphate proteoglycan
    • Intestinal protein OCI 5
    • Intestinal protein OCI-5
    • MXR7
    • OCI 5
    • OCI-5
    • OCI5
    • SDYS
    • Secreted glypican-3
    • SGB
    • SGBS
    • SGBS1
    see all
  • Function
    Cell surface proteoglycan that bears heparan sulfate. Inhibits the dipeptidyl peptidase activity of DPP4. May be involved in the suppression/modulation of growth in the predominantly mesodermal tissues and organs. May play a role in the modulation of IGF2 interactions with its receptor and thereby modulate its function. May regulate growth and tumor predisposition.
  • Tissue specificity
    Highly expressed in lung, liver and kidney.
  • Involvement in disease
    Defects in GPC3 are the cause of Simpson-Golabi-Behmel syndrome type 1 (SGBS1) [MIM:312870]; also known as Simpson dysmorphia syndrome (SDYS). SGBS is a condition characterized by pre- and postnatal overgrowth (gigantism) with visceral and skeletal anomalies.
  • Sequence similarities
    Belongs to the glypican family.
  • Cellular localization
    Cell membrane and Secreted > extracellular space.
  • Information by UniProt

Recombinant Human Glypican 3 protein images

  • SDS-PAGE analysis of ab114311 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human Glypican 3 protein (ab114311)

ab114311 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114311.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up