Recombinant Human Glypican 5 protein (ab152384)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDAQTWPVGFRCLLLLALVGSARSEGVQTCEEVRKLFQWRLLGAVRGLPD SPRAGPDLQVCISKKPTCCTRKMEERYQIAARQDMQQFLQTSSSTLKFLI SRNAAAFQETLETLIKQAENYTSILFCSTYRNMALEAAASVQEFFTDVGL YLFGADVNPEEFVNRFFDSLFPLVYNHLINPGVTDSSLEYSECIRMARRD VSPFGNIPQRVMGQMGRSLLPSRTFLQALNLGIEVINTTDYLHFSKECSR ALLKMQYCPHCQGLALTKPCMGYCLNVMRGCLAHMAELNPHWHAYIRSLE ELSDAMHGTYDIGHVLLNFHLLVNDAVLQAHLNGQKLLEQVNRICGRPVR TPTQSPRCSFDQSKEKHGMKTTTRNSEETLANRRKEFINSLRLYRSFYGG LADQLCANELAAADGLPCWNGEDIVKSYTQRVVGNGIKAQSGNPEVKVKG IDPVINQIIDKLKHVVQLLQGRSPKPDKWELLQLGSGGGMVEQVSGDCDD EDGCGGSGSGEVKRTLKITDWMPDDMNFSDVKQIHQTDTGSTLDTTGAGC AVATESMTFTLISVVMLLPGIW
    • Molecular weight
      89 kDa including tags
    • Amino acids
      1 to 572

Specifications

Our Abpromise guarantee covers the use of ab152384 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA93M14.1
    • glypican 5
    • Glypican 5 precursor
    • glypican proteoglycan 5
    • Glypican-5
    • GPC5
    • GPC5_HUMAN
    • Secreted glypican-5
    see all
  • Function
    Cell surface proteoglycan that bears heparan sulfate.
  • Tissue specificity
    In adult, primarily expressed in the brain. Also detected in fetal brain, lung and liver.
  • Sequence similarities
    Belongs to the glypican family.
  • Cellular localization
    Cell membrane and Secreted > extracellular space.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152384 stained with Coomassie Blue.

References

ab152384 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152384.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up