Overview

  • Product name
    Recombinant Human GLYR1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIKINKGKRFQQAVDAVEEFLRRAKGKDQTSSHNSSDDKNRRNSSEERSR PNSGDEKRKLSLSEGKVKKNMGEGKKRVSSGSSERGSKSPLKRAQEQSPR KRGRPPKDEKDLTIPESSTVKGMMAGPMAAFKWQPTASEPVKDADPHFHH FLLSQTEKPAVCYQAITKKLKICEEETGSTSIQAADSTAVNGSITPTDKK IGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAE VVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVT ELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQA MGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLL DILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNH PTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH
    • Amino acids
      1 to 484
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164628 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3 hydroxyisobutyrate dehydrogenase like protein
    • 3-hydroxyisobutyrate dehydrogenase-like protein
    • BM045
    • Cytokine like nuclear factor n pac
    • Cytokine-like nuclear factor N-PAC
    • Glyoxylate reductase 1 homolog
    • GLYR1
    • GLYR1_HUMAN
    • HIBDL
    • N-PAC
    • NP60
    • Nuclear protein 60 kDa
    • Nuclear protein NP60
    • Nuclear protein of 60 kDa
    • Putative oxidoreductase GLYR1
    see all
  • Function
    May have oxidoreductase activity. Regulates p38 MAP kinase activity by mediating stress activation of p38alpha/MAPK14 and specifically regulating MAPK14 signaling. Indirectly promotes phosphorylation of MAPK14 and activation of ATF2. The phosphorylation of MAPK14 requires upstream activity of MAP2K4 and MAP2K6. Recruited on chromatin, recognizes and binds trimethylated 'Lys-36' of histone H3 (H3K36me3).
  • Sequence similarities
    Belongs to the 3-hydroxyisobutyrate dehydrogenase family. NP60 subfamily.
    Contains 1 A.T hook DNA-binding domain.
    Contains 1 PWWP domain.
  • Domain
    The A.T hook DNA-binding domain is required for the interaction with MAPK14.
    The PWWP domain probably mediates the binding to H3K36me3.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab164628 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164628 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164628.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up