Overview

  • Product name
    Recombinant Human Glyt2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKN STFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIR
    • Amino acids
      294 to 393
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160362 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Glycine transporter
    • Glycine transporter type 2
    • GlyT-2
    • GlyT2
    • NET1
    • SC6A5_HUMAN
    • SC6AC5
    • Slc6a5
    • SLC6A5 solute carrier family 6 neurotransmitter transporter, glycine member 5
    • Slc6a9
    • Sodium and chloride dependent glycine transporter 2
    • Sodium- and chloride-dependent glycine transporter 2
    • Solute carrier family 6 member 5
    • Solute carrier family 6 neurotransmitter transporter glycine member 5
    see all
  • Function
    Terminates the action of glycine by its high affinity sodium-dependent reuptake into presynaptic terminals. May be responsible for the termination of neurotransmission at strychnine-sensitive glycinergic synapses.
  • Tissue specificity
    Expressed in medulla, and to a lesser extent in spinal cord and cerebellum.
  • Involvement in disease
    Hyperekplexia 3
  • Sequence similarities
    Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A5 subfamily.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160362 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160362 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160362.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up