Overview

Description

  • NatureRecombinant
  • SourceInsect cells
  • Amino Acid Sequence
    • AccessionP04141
    • SpeciesHuman
    • SequenceAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQ EPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQI ITFESFKENLKDFLLVIPFDCWEPVQETRHHHHHH
    • Amino acids18 to 144
    • TagsHis tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab50999 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    > 98% by SDS-PAGE and visualized by Silver stain.
  • FormLyophilised
  • Additional notesSource: Insect cells.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

  • ReconstitutionThe lyophilized GM-CSF is soluble in water and most aqueous buffers. The lyophilized powder can be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted into other buffered solutions.

General Info

  • Alternative names
    • Colony stimulating factor
    • Colony Stimulating Factor 2
    • Colony stimulating factor 2 (granulocyte-macrophage)
    • Colony-stimulating factor
    • CSF
    • CSF 2
    • CSF2
    • CSF2_HUMAN
    • GM-CSF
    • GMCSF
    • Granulocyte Macrophage Colony Stimulating Factor
    • Granulocyte-macrophage colony-stimulating factor
    • MGC131935
    • MGC138897
    • MGI1GM
    • Molgramostin
    • Pluripoietin-a
    • Sargramostim
    see all
  • FunctionCytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
  • Sequence similaritiesBelongs to the GM-CSF family.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human GM-CSF protein images

  • SDS-PAGE of recombinant human GM-CSF. The sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and stained with Coomassie blue. The bands correspond to different glycolsylation forms.

References for Recombinant Human GM-CSF protein (ab50999)

ab50999 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab50999.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"