Recombinant human GM-CSF Receptor alpha protein (Fc Chimera) (ab83993)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • AccessionP15509
    • SpeciesHuman
    • SequenceTheoretical Sequence: EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVV EPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREG TAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCP YYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKK IERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNT QPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWS EAIEFGSDDGGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFL FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN HYTQKSLSLSPGK
    • Additional sequence informationFusion of aa 1-320 of human GM-CSF Receptor alpha and aa 90-330 of Fc region of human IgG1 (P01857). The chimeric protein was expressed in modified human 293 cells.

Specifications

Our Abpromise guarantee covers the use of ab83993 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityab83993 bound to protein A sepharose beads was able to pull down its ligand, GM-CSF.
  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.

  • FormLyophilised
  • Additional notesab83993 bound to protein A sepharose beads was able to pull down its ligand, GM-CSF.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • CD_antigen=CD116
    • CD116
    • CD116 antigen
    • CDw116
    • Colony stimulating factor 2 receptor alpha chain
    • Colony stimulating factor 2 receptor alpha low affinity
    • Colony stimulating factor 2 receptor alpha subunit
    • CSF 2R
    • CSF2R
    • CSF2R_HUMAN
    • CSF2RA
    • CSF2RAX
    • CSF2RAY
    • CSF2RX
    • CSF2RY
    • GM CSF R alpha
    • GM CSF receptor alpha subunit
    • GM-CSF-R-alpha
    • GMCSFR
    • GMCSFR-alpha
    • GMR-alpha
    • Granulocyte macrophage colony stimulating factor receptor alpha chain
    • Granulocyte-macrophage colony-stimulating factor receptor subunit alpha
    • SMDP4
    see all
  • FunctionLow affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells.
  • Involvement in diseaseDefects in CSF2RA are the cause of pulmonary surfactant metabolism dysfunction type 4 (SMDP4) [MIM:300770]. A rare lung disorder due to impaired surfactant homeostasis. It is characterized by alveolar filling with floccular material that stains positive using the periodic acid-Schiff method and is derived from surfactant phospholipids and protein components. Excessive lipoproteins accumulation in the alveoli results in severe respiratory distress.
  • Sequence similaritiesBelongs to the type I cytokine receptor family. Type 5 subfamily.
  • DomainThe WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localizationSecreted and Cell membrane.
  • Information by UniProt

Recombinant human GM-CSF Receptor alpha protein (Fc Chimera) images

  • Densitometry of protein isoforms visualised by 2-DE.
    The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
    The triangle indicates the theoretical MW and pI of the protein.
  • 1D SDS-PAGE of ab83993 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1: ab83993
    Lane 2: ab83993 treated with PNGase F to remove potential N-linked glycans
    Lane 3: ab83993 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
    Approximately 5 μg of protein was loaded per lane; Gel was stained using Deep Purple™.

    Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. A tightening of the band after treatment with the glycosidase cocktail indicates O-linked glycans may be present. Additional bands in lane 2 and lane 3 are glycosidase enzymes.

References for Recombinant human GM-CSF Receptor alpha protein (Fc Chimera) (ab83993)

ab83993 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83993.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"