Overview

  • Product nameRecombinant Human GMDS protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO60547
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAHAPARCPSARGSGDGEMGKPRNVALITG ITGQDGSYLAEFLLEKGY EVHGIVRRSSSFNTGRIEHLYKNPQAHIEG NMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDLAEY TAD VDGVGTLRLLDAVKTCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPR SPYGAAKLYAYWIVVNFREAYN LFAVNGILFNHESPRRGANFVTRKIS RSVAKIYLGQLECFSLGNLDAKRDWGHAKDYVEAMWLMLQNDEPEDFVI ATGEVHSVREFVEKSFLHIGKTIVWEGKNENEVGRCKETGKVHVTVDLK YYRPTEVDFLQGDCTKAKQKLNWKPR VAFDELVREMVHADVELMRTNP NA
    • Molecular weight44 kDa including tags
    • Amino acids1 to 372
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113860 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab113860 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 30% Glycerol, 0.58% Sodium chloride, 0.02% DTT, 0.002% PMSF

General Info

  • Alternative names
    • GDP D mannose dehydratase
    • GDP mannose 4 6 dehydratase
    • GDP-D-mannose dehydratase
    • GDP-mannose 4,6 dehydratase
    • GMD
    • Gmds
    • GMDS_HUMAN
    • OTTHUMP00000017756
    • OTTHUMP00000232770
    • SDR3E1
    • Short chain dehydrogenase/reductase family 3E member 1
    see all
  • FunctionConversion of GDP-D-mannose to GDP-4-keto-6-D-deoxymannose.
  • PathwayNucleotide-sugar biosynthesis; GDP-L-fucose biosynthesis via de novo pathway; GDP-L-fucose from GDP-alpha-D-mannose: step 1/2.
  • Sequence similaritiesBelongs to the GDP-mannose 4,6-dehydratase family.
  • Information by UniProt

Recombinant Human GMDS protein images

  • 15% SDS-PAGE analysis of ab113860 (3µg)

References for Recombinant Human GMDS protein (ab113860)

ab113860 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113860.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"