Overview

  • Product name
    Recombinant Human GMDS protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAHAPARCPSARGSGDGEMGKPRNVALITG ITGQDGSYLAEFLLEKGY EVHGIVRRSSSFNTGRIEHLYKNPQAHIEG NMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDLAEY TAD VDGVGTLRLLDAVKTCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPR SPYGAAKLYAYWIVVNFREAYN LFAVNGILFNHESPRRGANFVTRKIS RSVAKIYLGQLECFSLGNLDAKRDWGHAKDYVEAMWLMLQNDEPEDFVI ATGEVHSVREFVEKSFLHIGKTIVWEGKNENEVGRCKETGKVHVTVDLK YYRPTEVDFLQGDCTKAKQKLNWKPR VAFDELVREMVHADVELMRTNP NA
    • Molecular weight
      44 kDa including tags
    • Amino acids
      1 to 372
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113860 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab113860 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 30% Glycerol, 0.58% Sodium chloride, 0.02% DTT, 0.002% PMSF

General Info

  • Alternative names
    • GDP D mannose dehydratase
    • GDP mannose 4 6 dehydratase
    • GDP-D-mannose dehydratase
    • GDP-mannose 4,6 dehydratase
    • GMD
    • Gmds
    • GMDS_HUMAN
    • OTTHUMP00000017756
    • OTTHUMP00000232770
    • SDR3E1
    • Short chain dehydrogenase/reductase family 3E member 1
    see all
  • Function
    Conversion of GDP-D-mannose to GDP-4-keto-6-D-deoxymannose.
  • Pathway
    Nucleotide-sugar biosynthesis; GDP-L-fucose biosynthesis via de novo pathway; GDP-L-fucose from GDP-alpha-D-mannose: step 1/2.
  • Sequence similarities
    Belongs to the GDP-mannose 4,6-dehydratase family.
  • Information by UniProt

Recombinant Human GMDS protein images

  • 15% SDS-PAGE analysis of ab113860 (3µg)

References for Recombinant Human GMDS protein (ab113860)

ab113860 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113860.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up