Overview

  • Product name
    Recombinant Human GMDS protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAHAPARCPSARGSGDGEMGKPRNVALITG ITGQDGSYLAEFLLEKGY EVHGIVRRSSSFNTGRIEHLYKNPQAHIEG NMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDLAEY TAD VDGVGTLRLLDAVKTCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPR SPYGAAKLYAYWIVVNFREAYN LFAVNGILFNHESPRRGANFVTRKIS RSVAKIYLGQLECFSLGNLDAKRDWGHAKDYVEAMWLMLQNDEPEDFVI ATGEVHSVREFVEKSFLHIGKTIVWEGKNENEVGRCKETGKVHVTVDLK YYRPTEVDFLQGDCTKAKQKLNWKPR VAFDELVREMVHADVELMRTNP NA
    • Molecular weight
      44 kDa including tags
    • Amino acids
      1 to 372
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113860 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab113860 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 30% Glycerol, 0.58% Sodium chloride, 0.02% DTT, 0.002% PMSF

General Info

  • Alternative names
    • GDP D mannose dehydratase
    • GDP mannose 4 6 dehydratase
    • GDP-D-mannose dehydratase
    • GDP-mannose 4,6 dehydratase
    • GMD
    • Gmds
    • GMDS_HUMAN
    • OTTHUMP00000017756
    • OTTHUMP00000232770
    • SDR3E1
    • Short chain dehydrogenase/reductase family 3E member 1
    see all
  • Function
    Conversion of GDP-D-mannose to GDP-4-keto-6-D-deoxymannose.
  • Pathway
    Nucleotide-sugar biosynthesis; GDP-L-fucose biosynthesis via de novo pathway; GDP-L-fucose from GDP-alpha-D-mannose: step 1/2.
  • Sequence similarities
    Belongs to the GDP-mannose 4,6-dehydratase family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab113860 (3µg)

References

ab113860 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113860.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up