Overview

  • Product name
    Recombinant Human GMEB2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATPDVSVHMEEVVVVTTPDTAVDGSGVEGVKTVLVTTNLAPHGGDLTED NMETENAAAAAAAAFTASSQLKEAVLVKMAEEGENLEAEIVYPITCGDSR ANLIWRKFVCPGINVKCVQYDEHVISPKEFVHLAGKSTLKDWKRAIRMNG IMLRKIMDSGELDFYQHDKVCSNTCRSTKIDLSGARVSLSSPTSAEYIPL TPAAADVNGSPATITIETCEDPGDWTAAIGDDTFTFWRGLKDAGLLDEVI QEFHQELVETMRGLQQRVQDPPLQLRDAVLLNNIVQNFGMLDLVKKVLAS HKCQMDRSREQYARDLAALEQQCDEHRRRAKELKHKSQHLSNVLMTLTPV SLPPPVKRPRLARATSGPAAMASQVLTQSAQLALGPGVPVPQLTSVPLGK VVSTLPSTVLGKGSLQAPPASSPASPLLGGYTVLASSGSTYPSTVEIHPD ASSLTVLSTAAVQDGSTVFKVVSPLQLLTLPGLGPTLQNVAQASPGSSTI VTVPAGAAPGPEEHTATIEVAAMAEDHERK
    • Amino acids
      1 to 530
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161922 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GMEB2
    • DNA binding protein p79PIF
    • DNA-binding protein p79PIF
    • Glucocorticoid modulatory element binding protein 2
    • Glucocorticoid modulatory element-binding protein 2
    • GMEB 2
    • GMEB-2
    • Gmeb2
    • GMEB2_HUMAN
    • KIAA1269
    • P79PIF
    • Parvovirus initiation factor p79
    • PIF p79
    • PIF79
    • RP4 663D7.1
    see all
  • Function
    Trans-acting factor that binds to glucocorticoid modulatory elements (GME) present in the TAT (tyrosine aminotransferase) promoter and increases sensitivity to low concentrations of glucocorticoids. Binds also to the transferrin receptor promoter. Essential auxiliary factor for the replication of parvoviruses.
  • Tissue specificity
    Expressed in peripheral blood lymphocytes and fetal liver. Expressed preferentially in reproductive and/or developmentally important cells, such as testis, placenta, bone marrow and fetal tissues.
  • Sequence similarities
    Contains 1 SAND domain.
  • Cellular localization
    Nucleus. Cytoplasm. May be also cytoplasmic.
  • Information by UniProt

Images

  • ab161922 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161922 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161922.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up