Recombinant Human GMF beta protein (ab123842)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEG ISPDELKELPERQPR FIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQ QMMYAGSKNKLVQTAELTKVFEIRNTEDLT EEWLREKLGFFH
    • Molecular weight
      17 kDa
    • Amino acids
      2 to 141

Associated products

Specifications

Our Abpromise guarantee covers the use of ab123842 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Purity
    > 98 % SDS-PAGE.
    Purity is greater than 98% as determined by HPLC and SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Store under desiccating conditions.

    Information available upon request.

  • Reconstitution
    Centrifuge the vial prior to opening. Reconstitute in sterile H2O to a concentration of 100 µg/ml. This solution can then be diluted into other aqueous buffers. Reconstituted ab123842 should be stored at 4°C for 2-7 days and at -20°C for future use. For long term storage it is recommended to add a carrier protein (0.1 % HSA or BSA). Avoid freeze/thaw cycles.

General Info

  • Alternative names
    • Glia maturation factor beta
    • GMF
    • GMF-beta
    • GMFB
    • GMFB_HUMAN
    see all
  • Function
    This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells.
  • Sequence similarities
    Belongs to the actin-binding proteins ADF family. GMF subfamily.
    Contains 1 ADF-H domain.
  • Post-translational
    modifications
    Phosphorylated; stimulated by phorbol ester.
  • Information by UniProt

References

ab123842 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab123842.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up