Recombinant Human GMF beta protein (ab123842)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP60983
    • SpeciesHuman
    • SequenceSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEG ISPDELKELPERQPR FIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQ QMMYAGSKNKLVQTAELTKVFEIRNTEDLT EEWLREKLGFFH
    • Molecular weight17 kDa
    • Amino acids2 to 141

Specifications

Our Abpromise guarantee covers the use of ab123842 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Purity> 98 % SDS-PAGE.
    Purity is greater than 98% as determined by HPLC and SDS-PAGE.
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Store under Desiccating conditions.

    Information available upon request.

  • ReconstitutionCentrifuge the vial prior to opening. Reconstitute in sterile H2O to a concentration of 100 µg/ml. This solution can then be diluted into other aqueous buffers. Reconstituted ab123842 should be stored at 4°C for 2-7 days and at -20°C for future use. For long term storage it is recommended to add a carrier protein (0.1 % HSA or BSA). Avoid freeze/thaw cycles.

General Info

  • Alternative names
    • Glia maturation factor beta
    • GMF
    • GMF-beta
    • GMFB
    • GMFB_HUMAN
    see all
  • FunctionThis protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells.
  • Sequence similaritiesBelongs to the actin-binding proteins ADF family. GMF subfamily.
    Contains 1 ADF-H domain.
  • Post-translational
    modifications
    Phosphorylated; stimulated by phorbol ester.
  • Information by UniProt

References for Recombinant Human GMF beta protein (ab123842)

ab123842 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123842.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"