Recombinant Human GMF beta protein (ab99216)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSESLVVCDVAEDLVEKLRKFRFRKETNNA AIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDG RVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLT EEWLREKLGFFH
    • Molecular weight
      19 kDa including tags
    • Amino acids
      1 to 142
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99216 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab99216 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Glia maturation factor beta
    • GMF
    • GMF-beta
    • GMFB
    • GMFB_HUMAN
    see all
  • Function
    This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells.
  • Sequence similarities
    Belongs to the actin-binding proteins ADF family. GMF subfamily.
    Contains 1 ADF-H domain.
  • Post-translational
    modifications
    Phosphorylated; stimulated by phorbol ester.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab99216.

References

ab99216 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99216.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up