Recombinant Human GMF beta protein (ab99216)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSESLVVCDVAEDLVEKLRKFRFRKETNNA AIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDG RVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLT EEWLREKLGFFH
    • Molecular weight
      19 kDa including tags
    • Amino acids
      1 to 142
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99216 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab99216 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Glia maturation factor beta
    • GMF
    • GMF-beta
    • GMFB
    • GMFB_HUMAN
    see all
  • Function
    This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells.
  • Sequence similarities
    Belongs to the actin-binding proteins ADF family. GMF subfamily.
    Contains 1 ADF-H domain.
  • Post-translational
    modifications
    Phosphorylated; stimulated by phorbol ester.
  • Information by UniProt

Recombinant Human GMF beta protein images

  • 15% SDS-PAGE analysis of 3µg ab99216.

References for Recombinant Human GMF beta protein (ab99216)

ab99216 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99216.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up